PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G245800.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family WOX
Protein Properties Length: 314aa    MW: 33666.4 Da    PI: 7.0422
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G245800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.79.8e-093402457
                       S--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox 24 ypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                       +p ++e++++  +l    ++ +++V++WFqNr+ + k+
  Aqcoe1G245800.2.p  3 NPPRDEIRRIRVQLqeygQVGDANVFYWFQNRKSRSKH 40
                       7999*******************************995 PP

2Wus_type_Homeobox67.62.3e-221422465
  Wus_type_Homeobox 24 lrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +++P+++ei+ri+ +L+eyG+++d+NVfyWFQNrk+R+++kq
  Aqcoe1G245800.2.p  1 MVNPPRDEIRRIRVQLQEYGQVGDANVFYWFQNRKSRSKHKQ 42
                       78**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF000462.9E-6340IPR001356Homeobox domain
SuperFamilySSF466895.26E-6344IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MVNPPRDEIR RIRVQLQEYG QVGDANVFYW FQNRKSRSKH KQRSHLHTSK SHTQSSSVAA  60
TTFVGPSSSS SSSEKSPPKR TNKLLQMGSS GMNIMDAANS PTASVNQTYF QSQGDFSADP  120
FFYPVAQQAG NNNTLFSSQG LCFPELSNIV QIPDQVIVPC TGFLLSELVN QNATKRYEEE  180
EKLKLEQQLS YSTAVTTTNS TTTTTTTTTT PNTIPSSSTS VGSININQIQ GGGESGAGGL  240
GLATAAMKST VFINNVAVEV ALGPFNVRDA FGEDALLVHS SGQPVVTNEW GVTLQSLQPG  300
AVYYLVCASN IFA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273188.11e-108PREDICTED: WUSCHEL-related homeobox 9-like
TrEMBLF6HM561e-107F6HM56_VITVI; Putative uncharacterized protein
STRINGVIT_10s0003g00560.t011e-107(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.12e-24homeobox-3